Adam23 Rabbit Polyclonal Antibody

SKU TA339377

Rabbit Polyclonal Anti-Adam23 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Adam23 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NPNPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: a disintegrin and metallopeptidase domain 23
• Database Link:
  NP_035910
  Q9R1V7
• Background: May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.
• Synonyms: MDC-3; MDC3
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data