OriGene Logo

SLD5 (GINS4) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339370
Rabbit Polyclonal Anti-GINS4 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY403156 Transient overexpression lysate of GINS complex subunit 4 (Sld5 homolog) (GINS4) 100 ug
$436.00
TP303336 Recombinant protein of human GINS complex subunit 4 (Sld5 homolog) (GINS4), 20 µg
20 ug
$867.00

View other "SLD5 or NM_032336" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-GINS4 antibody is: synthetic peptide directed towards the N-terminal region of Human GINS4. Synthetic peptide located within the following region: TEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 26 kDa
Gene Name GINS complex subunit 4
Database Link
Background The yeast heterotetrameric GINS complex is made up of Sld5, Psf1 (GINS1; MIM 610608), Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 PubMed 16287864). See GINS1 for additional information about the GINS complex. supplied by OMIM, Mar 2008. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AK095334.1, BC005995.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025087, ERS025093 ECO:0000348 ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms SLD5
Note Immunogen Sequence Homology: Human: 100%; Mouse: 80%; Pig: 79%; Horse: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.