GRPEL1 Rabbit Polyclonal Antibody

SKU TA339367

Rabbit Polyclonal Anti-GRPEL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRPEL1 antibody: synthetic peptide directed towards the N terminal of human GRPEL1. Synthetic peptide located within the following region: NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: GrpE like 1, mitochondrial
• Database Link:
  NP_079472
  Q9HAV7
• Background: GRPEL1 is essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL1 seems to control the nucleotide-depe
• Synonyms: HMGE
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 75%; Guinea pig: 75%

Reference Data