BLAP75 (RMI1) Rabbit Polyclonal Antibody

SKU TA339366

Rabbit Polyclonal Anti-RMI1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RMI1 antibody: synthetic peptide directed towards the N terminal of human RMI1. Synthetic peptide located within the following region: DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 70 kDa
• Gene Name: RecQ mediated genome instability 1
• Database Link:
  NP_079221
  Q9H9A7
• Background: RMI1 is a component of protein complexes that limit DNA crossover formation via the dissolution of double Holliday junctions (Raynard et al., 2006 [PubMed 16595695]). [supplied by OMIM, Mar 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK022950.1, DN997105.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: BLAP75; C9orf76; FAAP75
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data