C2ORF47 (MAIP1) Rabbit Polyclonal Antibody

SKU TA339364

Rabbit Polyclonal Anti-C2orf47 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C2orf47 antibody: synthetic peptide directed towards the middle region of human C2orf47. Synthetic peptide located within the following region: GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: chromosome 2 open reading frame 47
• Database Link:
  NP_078796
  Q8WWC4
• Background: The function of the C2orf47 protein remains unknown.
• Synonyms: DKFZp666A212; FLJ22555
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data