PSF1 (GINS1) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-GINS1 antibody: synthetic peptide directed towards the N terminal of human GINS1. Synthetic peptide located within the following region: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 23 kDa |
| Gene Name | GINS complex subunit 1 |
| Database Link | |
| Background | The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 PubMed 16287864). supplied by OMIM, Mar 2008. ##Evidence-Data-START## Transcript exon combination :: D80008.1, BC012542.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025087, ERS025092 ECO:0000348 ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. |
| Synonyms | PSF1 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 86% |
| Reference Data | |
| Protein Categories | Immune system diseases, Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Tissue-Specific Requirement for the GINS Complex During Zebrafish Development
Varga, Csályi, Bertyák et al
Front Cell Dev Biol (2020) 8, 373 DOI: 10.3389/fcell.2020.00373
Varga, Csályi, Bertyák et al
Front Cell Dev Biol (2020) 8, 373 DOI: 10.3389/fcell.2020.00373
Cited by 8
AI Summary: OriGene contributed to this study by providing the Gins1/Psf1 antibody (OriGene, TA339351), which was used for immunoblotting to detect Gins1 protein levels in zebrafish tissue samples.
Snippet: reducing sample buffer (Bio-Rad 1610737), sonicated for 3 min and separated by SDS-PAGE and transferred to nitrocellulose membranes. Membranes were immunoblotted using antibodies against Gins1/Psf1 (Origene, TA339351), Gins2/Psf2 (Novus Biologicals, NBP1-58209) and γ-tubulin (Sigma-Aldrich, T6557). Bindings were revealed by a HRP-conjugated anti-mouse/rabbit IgG antibodies (Dako) and ECL (Advans
The GINS complex is required for the survival of rapidly proliferating retinal and tectal progenitor cells during zebrafish development
Varga, Csalyi, Bertyak et al
bioRxiv (2020)
Varga, Csalyi, Bertyak et al
bioRxiv (2020)
Cited by 1
Snippet: For Western blot analysis 10 embryos were lysed in 2x Laemmli reducing sample buffer (Bio-Rad 1610737), sonicated for 3 min and separated by SDS-PAGE and transferred to nitrocellulose membranes. Membranes were immunoblotted using antibodies against Psf1 (Origene, TA339351) Psf2 (Novus Biologicals, NBP1-58209) and γ-tubulin (Sigma, T6557). …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
