CEP55 Rabbit Polyclonal Antibody

SKU TA339345

Rabbit Polyclonal Anti-CEP55 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CEP55 antibody: synthetic peptide directed towards the N terminal of human CEP55. Synthetic peptide located within the following region: MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: centrosomal protein 55
• Database Link:
  NP_060601
  Q53EZ4
• Background: CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
• Synonyms: C10orf3; CT111; URCC6
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 92%; Dog: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 85%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome