CEP55 Rabbit Polyclonal Antibody

SKU
TA339345
Rabbit Polyclonal Anti-CEP55 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CEP55 antibody: synthetic peptide directed towards the N terminal of human CEP55. Synthetic peptide located within the following region: MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 54 kDa
Gene Name centrosomal protein 55
Database Link
Background CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
Synonyms C10orf3; CT111; URCC6
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 92%; Dog: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 85%; Horse: 79%
Reference Data
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:CEP55 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.