UBP43 (USP18) Rabbit Polyclonal Antibody

SKU TA339338

Rabbit Polyclonal Anti-USP18 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP18 antibody: synthetic peptide directed towards the N terminal of human USP18. Synthetic peptide located within the following region: MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: ubiquitin specific peptidase 18
• Database Link:
  NP_059110
  Q9UMW8
• Background: The protein encoded by this gene belongs to the ubiquitin-specific proteases (UBP) family of enzymes that cleave ubiquitin from ubiquitinated protein substrates. It is highly expressed in liver and thymus, and is localized to the nucleus. This protein efficiently cleaves only ISG15 (a ubiquitin-like protein) fusions, and deletion of this gene in mice results in a massive increase of ISG15 conjugates in tissues, indicating that this protein is a major ISG15-specific protease. Mice lacking this gene are also hypersensitive to interferon, suggesting a function of this protein in downregulating interferon responses, independent of its isopeptidase activity towards ISG15. [provided by RefSeq, Sep 2011]
• Synonyms: ISG43; UBP43
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 92%; Dog: 86%; Horse: 86%; Rat: 85%; Mouse: 85%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Protease