C1orf33 (MRTO4) Rabbit Polyclonal Antibody

SKU TA339334

Rabbit Polyclonal Anti-MRTO4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRTO4 antibody: synthetic peptide directed towards the N terminal of human MRTO4. Synthetic peptide located within the following region: SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: MRT4 homolog, ribosome maturation factor
• Database Link:
  NP_057267
  Q9UKD2
• Background: This gene encodes a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the encoded protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly. [provided by RefSeq, Jul 2008]
• Synonyms: C1orf33; dJ657E11.4; MRT4
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 90%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome