PFAS Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PFAS antibody: synthetic peptide directed towards the N terminal of human PFAS. Synthetic peptide located within the following region: ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 145 kDa |
| Gene Name | phosphoribosylformylglycinamidine synthase |
| Database Link | |
| Background | Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. The enzyme encoded by this gene catalyzes the fourth step of IMP biosynthesis. provided by RefSeq, Jul 2008 |
| Synonyms | FGAMS; FGAR-AT; FGARAT; PURL |
| Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 92%; Pig: 86%; Guinea pig: 86%; Bovine: 83%; Rabbit: 79% |
| Reference Data | |
| Protein Categories | Enzyme: Ligase, Intracellular Proteins |
| Protein Pathways | Metabolic pathways, Purine metabolism |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
