OriGene Logo

PFAS Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339309
Rabbit Polyclonal Anti-PFAS Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415790 Transient overexpression lysate of phosphoribosylformylglycinamidine synthase (PFAS) 100 ug
$665.00
TP317795 Recombinant protein of human phosphoribosylformylglycinamidine synthase (PFAS), 20 µg
20 ug
$737.00

View other "PFAS or NM_012393" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PFAS antibody: synthetic peptide directed towards the N terminal of human PFAS. Synthetic peptide located within the following region: ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 145 kDa
Gene Name phosphoribosylformylglycinamidine synthase
Database Link
Background Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. The enzyme encoded by this gene catalyzes the fourth step of IMP biosynthesis. provided by RefSeq, Jul 2008
Synonyms FGAMS; FGAR-AT; FGARAT; PURL
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 92%; Pig: 86%; Guinea pig: 86%; Bovine: 83%; Rabbit: 79%
Reference Data
Protein Categories Enzyme: Ligase, Intracellular Proteins
Protein Pathways Metabolic pathways, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.