NUFIP2 Rabbit Polyclonal Antibody

SKU TA339240

Rabbit Polyclonal Anti-NUFIP2

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUFIP2 antibody: synthetic peptide directed towards the N terminal of human NUFIP2. Synthetic peptide located within the following region: IPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 76 kDa
• Gene Name: NUFIP2, FMR1 interacting protein 2
• Database Link:
  NP_065823
  Q7Z417
• Background: NUFIP2 binds RNA. It is phosphorylated upon DNA damage, probably by ATM or ATR. The exact functions of NUFIP2 remain unknown.
• Synonyms: 82-FIP; 182-FIP; FIP-82; PIG1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data