ARID5A Rabbit Polyclonal Antibody

SKU TA339228

Rabbit Polyclonal Anti-ARID5A

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARID5A antibody: synthetic peptide directed towards the N terminal of human ARID5A. Synthetic peptide located within the following region: MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGERE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: AT-rich interaction domain 5A
• Database Link:
  NP_997646
  Q03989
• Background: Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth. Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 [PubMed 15640446]). [supplied by OMIM]
• Synonyms: MRF-1; MRF1; RP11-363D14
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data