ARID5A Rabbit Polyclonal Antibody

SKU
TA339228
Rabbit Polyclonal Anti-ARID5A
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ARID5A antibody: synthetic peptide directed towards the N terminal of human ARID5A. Synthetic peptide located within the following region: MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGERE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 64 kDa
Gene Name AT-rich interaction domain 5A
Database Link
Background Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth. Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 [PubMed 15640446]). [supplied by OMIM]
Synonyms MRF-1; MRF1; RP11-363D14
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Write Your Own Review
You're reviewing:ARID5A Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.