EME2 Rabbit Polyclonal Antibody

SKU TA339219

Rabbit Polyclonal Anti-EME2

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EME2 antibody is: synthetic peptide directed towards the middle region of Human EME2. Synthetic peptide located within the following region: TTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEVR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: essential meiotic structure-specific endonuclease subunit 2
• Database Link:
  NP_001010865
  A4GXA9
• Background: EME2 forms a heterodimer with MUS81 that functions as an XPF-type flap/fork endonuclease in DNA repair .
• Synonyms: FLJ00151; gs125; SLX2B
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data