PHF13 Rabbit Polyclonal Antibody

SKU TA339151

Rabbit Polyclonal Anti-PHF13

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHF13 antibody: synthetic peptide directed towards the middle region of human PHF13. Synthetic peptide located within the following region: GSCATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: PHD finger protein 13
• Database Link:
  NP_722519
  Q86YI8
• Background: PHF13 contains 1 PHD-type zinc finger. The function of the PHF13 protein remains unknown.
• Synonyms: PHF5; SPOC1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors