ZNF75 (ZNF75D) Rabbit Polyclonal Antibody

SKU TA339145

Rabbit Polyclonal Anti-ZNF75 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF75 antibody: synthetic peptide directed towards the middle region of human ZNF75. Synthetic peptide located within the following region: LALSEQKRIKHWKMASKLILPESLSLLTFEDVAVYFSEEEWQLLNPLEKT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: zinc finger protein 75D
• Database Link:
  NP_009062
  P51815
• Background: This gene encodes a protein that likely functions as a transcription factor. The protein, which belongs to the ZNF75 family, includes an N-terminal SCAN domain, a KRAB box, and five C2H2-type zinc finger motifs. Another functional gene belonging to this family is located on chromosome 16, while pseudogenes have been identified on chromosomes 11 and 12. Alternative splicing results in multiple transcripts variants. [provided by RefSeq, Jun 2010]
• Synonyms: D8C6; ZKSCAN24; ZNF75; ZNF82; ZSCAN28
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 86%

Reference Data

• Protein Families: Transcription Factors