ZNF193 (ZSCAN9) Rabbit Polyclonal Antibody

SKU TA339124

Rabbit Polyclonal Anti-ZSCAN9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF193 antibody: synthetic peptide directed towards the middle region of human ZNF193. Synthetic peptide located within the following region: NEQTWEVSQQDPSHGEVGEHKDRIERQWGNLLGEGQHKCDECGKSFTQSS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: zinc finger and SCAN domain containing 9
• Database Link:
  NP_006290
  O15535
• Background: May be involved in transcriptional regulation.
• Synonyms: PRD51; ZNF193
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 79%

Reference Data

• Protein Families: Transcription Factors