N myc interactor (NMI) Rabbit Polyclonal Antibody

SKU TA339098

Rabbit Polyclonal Anti-NMI Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NMI antibody: synthetic peptide directed towards the middle region of human NMI. Synthetic peptide located within the following region: SFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: N-myc and STAT interactor
• Database Link:
  NP_004679
  Q13287
• Background: NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq, Jul 2008]
• Synonyms: N-myc (and STAT) interactor; N-myc-interactor; N-myc and STAT interactor; N-myc interactor
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Mouse: 86%; Pig: 79%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors