ZNF213 Rabbit Polyclonal Antibody

CAT#: TA339090

Rabbit Polyclonal Anti-ZNF213 Antibody

Product Images

WB Suggested Anti-ZNF213 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:12500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the N terminal of human ZNF213. Synthetic peptide located within the following region: ATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: zinc finger protein 213
• Database Link:
  NP_004211
  Entrez Gene 7760 Human
  UniProt ID O14771
• Background: C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression. [supplied by OMIM, Apr 2004]. Transcript Variant: This variant (2) uses an alternate donor splice site at the first exon, hence has a different 5' UTR compared to variant 1. Transcript variants 1 and 2 encode the same protein. ##Evidence-Data-START## Transcript exon combination :: AK289834.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025083, ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: CR53; ZKSCAN21; ZSCAN53
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%

Reference Data

• Protein Families: Transcription Factors