HFH4 (FOXJ1) Rabbit Polyclonal Antibody

SKU TA339060

Rabbit Polyclonal Anti-FOXJ1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXJ1 antibody: synthetic peptide directed towards the middle region of human FOXJ1. Synthetic peptide located within the following region: LGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: forkhead box J1
• Database Link:
  NP_001445
  Q92949
• Background: This gene encodes a member of the forkhead family of transcription factors. Similar genes in zebrafish and mouse have been shown to regulate the transcription of genes that control the production of motile cilia. The mouse ortholog also functions in the determination of left-right asymmetry. Polymorphisms in this gene are associated with systemic lupus erythematosus and allergic rhinitis. [provided by RefSeq, Sep 2009]
• Synonyms: FKHL13; HFH-4; HFH4
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Dog: 92%; Guinea pig: 92%; Mouse: 86%

Reference Data

• Protein Families: Transcription Factors