Timm17a Rabbit Polyclonal Antibody

SKU TA339040

Rabbit Polyclonal Anti-Timm17a Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Timm17a antibody is: synthetic peptide directed towards the N-terminal region of Rat Timm17a. Synthetic peptide located within the following region: DCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 18 kDa
• Gene Name: translocase of inner mitochondrial membrane 17 homolog A (yeast)
• Database Link:
  NP_062224
  O35092
• Background: human homolog is a translocase in the inner mitochondrial membrane [RGD, Feb 2006]. Sequence Note: This sequence has been modified as follows: removed 46 bp suspected to be vector contamination from the 3' end. ##Evidence-Data-START## Transcript exon combination :: AB006450.1, DV715276.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369727 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END##
• Synonyms: MIMT17; TIM17; TIM17A; TIMM17
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data