DLL1 Rabbit Polyclonal Antibody

SKU TA339016

Rabbit Polyclonal Anti-DLL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 78 kDa
• Gene Name: delta like canonical Notch ligand 1
• Database Link:
  NP_005609
  O00548
• Background: DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. [provided by RefSeq, Jul 2008]
• Synonyms: Delta; DELTA1; DL1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%

Reference Data

• Protein Families: Adult stem cells, Cancer stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transmembrane
• Protein Pathways: Notch signaling pathway