DDT Rabbit Polyclonal Antibody

SKU TA338989

Rabbit Polyclonal Anti-DDT Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDT antibody: synthetic peptide directed towards the N terminal of human DDT. Synthetic peptide located within the following region: PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 13 kDa
• Gene Name: D-dopachrome tautomerase
• Database Link:
  NP_001346
  P30046
• Background: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008]
• Synonyms: DDCT
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rat: 92%; Rabbit: 92%; Bovine: 85%; Pig: 77%; Mouse: 77%; Guinea pig: 75%

Reference Data