L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody

SKU
TA338980
Rabbit Polyclonal Anti-KYNU Antibody
$585.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 52 kDa
Gene Name kynureninase
Database Link
Background Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
Synonyms KYNUU
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Yeast: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families Protease
Protein Pathways Metabolic pathways, Tryptophan metabolism
Write Your Own Review
You're reviewing:L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.