NCF4 Rabbit Polyclonal Antibody

SKU TA338965

Rabbit Polyclonal Anti-NCF4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the N terminal of human NCF4. Synthetic peptide located within the following region: SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: neutrophil cytosolic factor 4
• Database Link:
  NP_038202
  Q15080
• Background: The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
• Synonyms: CGD3; NCF; P40PHOX; SH3PXD4
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Dog: 86%; Horse: 86%; Bovine: 85%; Rabbit: 85%; Guinea pig: 79%

Reference Data

• Protein Pathways: Leukocyte transendothelial migration