Protein downstream neighbor of Son (DONSON) Rabbit Polyclonal Antibody

SKU TA338938

Rabbit Polyclonal Anti-DONSON Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DONSON antibody: synthetic peptide directed towards the middle region of human DONSON. Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: downstream neighbor of SON
• Database Link:
  NP_060083
  Q9NYP3
• Background: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown. [provided by RefSeq, Jul 2008]
• Synonyms: B17; C21orf60
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%

Reference Data