MORC3 Rabbit Polyclonal Antibody

SKU TA338935

Rabbit Polyclonal Anti-MORC3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MORC3 antibody: synthetic peptide directed towards the N terminal of human MORC3. Synthetic peptide located within the following region: KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 107 kDa
• Gene Name: MORC family CW-type zinc finger 3
• Database Link:
  NP_056173
  Q14149
• Background: This gene encodes a protein that localizes to the nuclear matrix. The protein also has RNA binding activity, and has a predicted coiled-coil domain. [provided by RefSeq, Jul 2008]
• Synonyms: NXP2; ZCW5; ZCWCC3
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rat: 93%; Rabbit: 93%; Dog: 86%; Bovine: 86%; Horse: 79%

Reference Data