DYRK1A Rabbit Polyclonal Antibody

SKU TA338910

Rabbit Polyclonal Anti-Dyrk1a Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Dyrk1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 85 kDa
• Gene Name: dual specificity tyrosine phosphorylation regulated kinase 1A
• Database Link:
  NP_569120
  Q13627
• Background: Dyrk1a may play a role in a signaling pathway regulating nuclear functions of cell proliferation. Dyrk1a phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.
• Synonyms: DYRK; DYRK1; HP86; MNB; MNBH; MRD7
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase