OSTA (SLC51A) Rabbit Polyclonal Antibody

SKU TA338900

Rabbit Polyclonal Anti-SLC51A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OSTalpha antibody: synthetic peptide directed towards the middle region of human OSTalpha. Synthetic peptide located within the following region: LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: solute carrier family 51 alpha subunit
• Database Link:
  NP_689885
  Q86UW1
• Background: SLC51A is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood.SLC51A efficiently transports the major species of bile acids.
• Synonyms: OSTA; OSTalpha
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 92%; Rabbit: 92%; Guinea pig: 92%; Bovine: 86%; Mouse: 83%

Reference Data

• Protein Families: Transmembrane