METTL19 (TRMT44) Rabbit Polyclonal Antibody

SKU TA338872

Rabbit Polyclonal Anti-TRMT44 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C4orf23 antibody: synthetic peptide directed towards the N terminal of human C4orf23. Synthetic peptide located within the following region: LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: tRNA methyltransferase 44 homolog (S. cerevisiae)
• Database Link:
  NP_689757
  Q8IYL2
• Background: The specific function of this protein remains unknown.
• Synonyms: C4orf23; METTL19; TRM44
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 85%

Reference Data