EME1 Rabbit Polyclonal Antibody

SKU TA338858

Rabbit Polyclonal Anti-EME1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EME1 antibody: synthetic peptide directed towards the N terminal of human EME1. Synthetic peptide located within the following region: MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: essential meiotic structure-specific endonuclease 1
• Database Link:
  NP_689676
  Q96AY2
• Background: EME1 and MUS81 (MIM 606591) form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.EME1 and MUS81 (MIM 606591) form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication (Abraham et al., 2003 [PubMed 14609959]). [supplied by OMIM]
• Synonyms: MMS4L; SLX2A
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rat: 93%; Guinea pig: 92%; Horse: 86%; Rabbit: 86%; Bovine: 85%

Reference Data

• Protein Pathways: Homologous recombination