OriGene Logo

EME1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338858
Rabbit Polyclonal Anti-EME1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY431994 Transient overexpression lysate of essential meiotic endonuclease 1 homolog 1 (S. pombe) (EME1), transcript variant 1 100 ug
$436.00

View other "EME1 or NM_152463" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EME1 antibody: synthetic peptide directed towards the N terminal of human EME1. Synthetic peptide located within the following region: MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 63 kDa
Gene Name essential meiotic structure-specific endonuclease 1
Database Link
Background EME1 and MUS81 (MIM 606591) form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.EME1 and MUS81 (MIM 606591) form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication (Abraham et al., 2003 PubMed 14609959). supplied by OMIM
Synonyms MMS4L; SLX2A
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rat: 93%; Guinea pig: 92%; Horse: 86%; Rabbit: 86%; Bovine: 85%
Reference Data
Protein Categories Intracellular Proteins
Protein Pathways Homologous recombination
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.