ZADH1 (PTGR2) Rabbit Polyclonal Antibody

SKU TA338852

Rabbit Polyclonal Anti-PTGR2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZADH1 antibody: synthetic peptide directed towards the middle region of human ZADH1. Synthetic peptide located within the following region: ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: prostaglandin reductase 2
• Database Link:
  NP_689657
  Q8N8N7
• Background: PTGR2 is an enzyme involved in the metabolism of prostaglandins. PTGR2 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. PTGR2 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.
• Synonyms: HEL-S-298; PGR2; ZADH1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 93%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome