RAD9 homolog B (RAD9B) Rabbit Polyclonal Antibody

SKU TA338848

Rabbit Polyclonal Anti-RAD9B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RAD9B antibody is: synthetic peptide directed towards the C-terminal region of Human RAD9B. Synthetic peptide located within the following region: ATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: RAD9 checkpoint clamp component B
• Database Link:
  NP_001273460
  Q6WBX8
• Background: The function of this protein remains unknown.
• Synonyms: FLJ40346; hRAD9B; MGC75426
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Rabbit: 79%

Reference Data