C17orf57 (EFCAB13) Rabbit Polyclonal Antibody

SKU TA338825

Rabbit Polyclonal Anti-EFCAB13 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C17orf57 antibody: synthetic peptide directed towards the N terminal of human C17orf57. Synthetic peptide located within the following region: CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 110 kDa
• Gene Name: EF-hand calcium binding domain 13
• Database Link:
  NP_689560
  Q8IY85
• Background: The exact function of EFCAB13 remains unknown.
• Synonyms: C17orf57
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 85%; Bovine: 85%; Goat: 82%

Reference Data