SCN1B Rabbit Polyclonal Antibody

SKU
TA338796
Rabbit Polyclonal Anti-Scn1b Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Scn1b antibody is: synthetic peptide directed towards the N-terminal region of Rat Scn1b. Synthetic peptide located within the following region: TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 23 kDa
Gene Name sodium voltage-gated channel beta subunit 1
Database Link
Background has voltage sensitive sodium channel activity when coexpressed with alpha subunits; plays a role in initiation and propogation of the action potential RGD, Feb 2006. Transcript Variant: This variant (2) lacks an internal segment in the 3' UTR, compared to variant 1. Both variants 1 and 2 encode the same isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns ERS160565, ERS240718 ECO:0000348 ##Evidence-Data-END## ##RefSeq-Attributes-START## CDS uses downstream in-frame AUG :: upstream AUG and CDS extension is not conserved ##RefSeq-Attributes-END##
Synonyms ATFB13; BRGDA5; GEFSP1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%
Reference Data
Protein Categories Cardiovascular diseases, Intracellular Proteins, Membrane Proteins, Nervous system Diseases, Secreated Proteins
Protein Families Druggable Genome, Ion Channels: Sodium, Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.