KCTD12 Rabbit Polyclonal Antibody

SKU TA338730

Rabbit Polyclonal Anti-Kctd12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Kctd12 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Kctd12. Synthetic peptide located within the following region: PDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: potassium channel tetramerization domain containing 12
• Database Link:
  NP_612453
  Q96CX2
• Background: Kctd12 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.
• Synonyms: C13orf2; PFET1; PFETIN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%; Guinea pig: 91%

Reference Data

• Protein Families: Ion Channels: Other