TMEM149 (IGFLR1) Rabbit Polyclonal Antibody

SKU TA338667

Rabbit Polyclonal Anti-IGFLR1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM149 antibody: synthetic peptide directed towards the N terminal of human TMEM149. Synthetic peptide located within the following region: WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: IGF like family receptor 1
• Database Link:
  NP_078936
  Q9H665
• Background: IGFLR1 is a single-pass type I membrane protein. The exact function of IGFLR1 remains unknown.
• Synonyms: TMEM149
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane