LENG4 (MBOAT7) Rabbit Polyclonal Antibody

SKU TA338652

Rabbit Polyclonal Anti-MBOAT7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LENG4 antibody: synthetic peptide directed towards the C terminal of human LENG4. Synthetic peptide located within the following region: LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: membrane bound O-acyltransferase domain containing 7
• Database Link:
  NP_077274
  Q96N66
• Background: The function remains unknown.
• Synonyms: BB1; hMBOA-7; LENG4; LPIAT; LRC4; MBOA7; OACT7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Transmembrane