Dlk2 Rabbit Polyclonal Antibody

SKU TA338637

Rabbit Polyclonal Anti-Dlk2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Dlk2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dlk2. Synthetic peptide located within the following region: LVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: delta-like 2 homolog (Drosophila)
• Database Link:
  NP_997549
  Q8K1E3
• Background: Dlk2 regulates adipogenesis.
• Synonyms: DLK-2; EGFL9; MGC2487; MGC111055
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Horse: 86%; Guinea pig: 86%

Reference Data