LMF1 Rabbit Polyclonal Antibody

SKU TA338619

Rabbit Polyclonal Anti-LMF1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LMF1 antibody is: synthetic peptide directed towards the N-terminal region of Human LMF1. Synthetic peptide located within the following region: LNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: lipase maturation factor 1
• Database Link:
  NP_073610
  Q96S06
• Background: The function of this protein remains unknown.
• Synonyms: C16orf26; HMFN1876; JFP11; TMEM112; TMEM112A
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 85%; Bovine: 85%

Reference Data

• Protein Families: Transmembrane