LPPR2 (PLPPR2) Rabbit Polyclonal Antibody

SKU TA338613

Rabbit Polyclonal Anti-LPPR2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LPPR2 antibody: synthetic peptide directed towards the middle region of human LPPR2. Synthetic peptide located within the following region: NYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAALCA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: phospholipid phosphatase related 2
• Database Link:
  NP_073574
  Q96GM1
• Background: LPPR2 is a multi-pass membrane protein and belongs to the PA-phosphatase related phosphoesterase family. LPPR2 shows dynamic expression regulation during brain development and neuronal excitation.
• Synonyms: LPPR2; PRG4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane