PKDREJ Rabbit Polyclonal Antibody

SKU TA338560

Rabbit Polyclonal Anti-PKDREJ Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PKDREJ antibody: synthetic peptide directed towards the middle region of human PKDREJ. Synthetic peptide located within the following region: GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 254 kDa
• Gene Name: polycystin (PKD) family receptor for egg jelly
• Database Link:
  NP_006062
  Q9NTG1
• Background: This intronless gene encodes a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction. Alternative splice variants have been described but their biological natures have not been determined. [provided by RefSeq, Jul 2008]
• Synonyms: OTTHUMP00000028714; polycystic kidney disease (polycystin) and REJ (sperm receptor for egg jelly; polycystic kidney disease (polycystin) and REJ (sperm receptor for egg jelly homolog; receptor for egg jelly-like; sea urchin)-like; sea urchin homolog)-like
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane