CLIC2 Rabbit Polyclonal Antibody

CAT#: TA338519

Reviews ()
Write a review

Rabbit Polyclonal Anti-CLIC2 Antibody


 Product Datasheet for 'TA338519'

USD 310.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CLIC2 antibody: synthetic peptide directed towards the middle region of human CLIC2. Synthetic peptide located within the following region: HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml
Purification Protein A purified
Predicted Protein Size 27 kDa
Gene Name chloride intracellular channel 2
Background This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein may play a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of X-linked mental retardation-32. [provided by RefSeq, Aug 2013]
Synonyms CLIC2b; MRXS32; XAP121
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%
Reference Data
Protein Families Druggable Genome, Ion Channels: Other
Other products for "CLIC2"
Frequently bought together (2)
Transient overexpression lysate of chloride intracellular channel 2 (CLIC2)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
68 Mouse Clones