Cadherin 22 (CDH22) Rabbit Polyclonal Antibody

SKU TA338468

Rabbit Polyclonal Anti-CDH22 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDH22 antibody: synthetic peptide directed towards the N terminal of human CDH22. Synthetic peptide located within the following region: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: cadherin 22
• Database Link:
  NP_067071
  Q9UJ99
• Background: CDH22 is a member of the cadherin superfamily. CDH22 is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins.
• Synonyms: C20orf25; dJ998H6.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%

Reference Data

• Protein Families: Transmembrane