C19orf15 (CATSPERG) Rabbit Polyclonal Antibody

SKU TA338462

Rabbit Polyclonal Anti-CATSPERG Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CATSPERG antibody: synthetic peptide directed towards the C terminal of human CATSPERG. Synthetic peptide located within the following region: FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 92 kDa
• Gene Name: cation channel sperm associated auxiliary subunit gamma
• Database Link:
  NP_067008
  Q6ZRH7
• Background: CATSPERG is a single-pass type I membrane protein. The exact function of CATSPERG remains unknown.
• Synonyms: C19orf15
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Guinea pig: 86%; Rat: 79%

Reference Data

• Protein Families: Transmembrane