SPINT2 Rabbit Polyclonal Antibody

SKU TA338452

Rabbit Polyclonal Anti-SPINT2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPINT2 antibody: synthetic peptide directed towards the middle region of human SPINT2. Synthetic peptide located within the following region: MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: serine peptidase inhibitor, Kunitz type, 2
• Database Link:
  NP_066925
  O43291
• Background: HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the KD-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.
• Synonyms: DIAR3; HAI-2; HAI2; Kop; PB
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 100%

Reference Data

• Protein Families: Transmembrane