Kcnt1 Rabbit Polyclonal Antibody

SKU TA338442

Rabbit Polyclonal Anti-Kcnt1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Kcnt1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPYIGSSPTLCHLLPVKA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 140 kDa
• Gene Name: potassium channel, subfamily T, member 1
• Database Link:
  NP_780671
  Q6ZPR4
• Background: The function of this protein remains unknown.
• Synonyms: bA100C15.2; FLJ41282; KCa4.1; KIAA1422; SLACK
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data