CNNM4 Rabbit Polyclonal Antibody

SKU TA338406

Rabbit Polyclonal Anti-CNNM4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNNM4 antibody: synthetic peptide directed towards the middle region of human CNNM4. Synthetic peptide located within the following region: LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 86 kDa
• Gene Name: cyclin and CBS domain divalent metal cation transport mediator 4
• Database Link:
  NP_064569
  Q6P4Q7
• Background: CNNM4 belongs to the ACDP family.It is a metal transporter. The interaction with the metal ion chaperone COX11 suggests that CNNM4 may play a role in sensory neuron functions.
• Synonyms: ACDP4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 86%; Zebrafish: 83%

Reference Data

• Protein Families: Transmembrane