CNNM4 Rabbit Polyclonal Antibody

SKU
TA338406
Rabbit Polyclonal Anti-CNNM4 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CNNM4 antibody: synthetic peptide directed towards the middle region of human CNNM4. Synthetic peptide located within the following region: LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 86 kDa
Gene Name cyclin and CBS domain divalent metal cation transport mediator 4
Database Link
Background CNNM4 belongs to the ACDP family.It is a metal transporter. The interaction with the metal ion chaperone COX11 suggests that CNNM4 may play a role in sensory neuron functions.
Synonyms ACDP4
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 86%; Zebrafish: 83%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CNNM4 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.