MDM1 Rabbit Polyclonal Antibody

SKU
TA338402
Rabbit Polyclonal Anti-MDM1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MDM1 antibody: synthetic peptide directed towards the N terminal of human MDM1. Synthetic peptide located within the following region: GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 25 kDa
Gene Name Mdm1 nuclear protein
Database Link
Background MDM1 is a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. This gene encodes a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. In mouse several transcripts have been described for this gene which result from alternative polyadenylation, splicing and exon usage.
Synonyms FLJ95264
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Zebrafish: 85%
Reference Data
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:MDM1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.