OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CBS Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338394
Rabbit Polyclonal Anti-CBS Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY400017 Transient overexpression lysate of cystathionine-beta-synthase (CBS) (as WB positive control) 100 ug
$436.00
TP301755 Recombinant protein of human cystathionine-beta-synthase (CBS), 20 µg
20 ug
$737.00

View other "CBS or NM_000071" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human, Mouse, Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 60 kDa
Gene Name cystathionine-beta-synthase
Database Link
Background The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. Multiple alternatively spliced transcript variants have been found for this gene. provided by RefSeq, May 2010
Synonyms HIP4
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Glycine, Metabolic pathways, Selenoamino acid metabolism, serine and threonine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Mistimed H2S upregulation, Nrf2 activation and antioxidant proteins levels in renal tubular epithelial cells subjected to anoxia and reoxygenation
Eleftheriadis, Pissas, Nikolaou et al
Biomed Rep (2020) 13 (2), 3 DOI: 10.3892/br.2020.1309
Cited by 7
AI Summary: In this study, OriGene’s anti-CBS antibody (cat. no. TA338394) was used to detect CBS protein levels, helping to assess the role of H2S-producing enzymes in renal tubular epithelial cells under anoxia and reoxygenation conditions.
Snippet: Primary antibodies used were specific for CBS (1:1,000;cat. no. TA338394;OriGene Technologies Inc.), CSE (1:100;cat. no. sc-374249;Santa Cruz Biotechnology, Inc.), 3-MST (1:100;cat. no. sc-376168;Santa Cruz Biotechnology, Inc.),
WB
The H2S-Nrf2-Antioxidant Proteins Axis Protects Renal Tubular Epithelial Cells of the Native Hibernator Syrian Hamster from Reoxygenation-Induced Cell Death
Eleftheriadis, Pissas, Nikolaou et al
Biology (Basel) (2019) 8 (4) DOI: 10.3390/biology8040074
Snippet: Primary antibodies were rabbit polyclonal antibody against CBS (dilution: 1:1000, catalogue number TA338394, OriGene Technologies Inc., Rockville, MD, USA), mouse monoclonal against CSE (dilution: 1:100, catalogue number sc-374249, Santa Cruz Biotechnology Cached
WB
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products